None

Galaxy History ' Unnamed history'


DatasetAnnotation
1: Hertweck_Asparagales.fasta
440 sequences
format: fasta, database: ?
Info:
uploaded fasta file
>scf7180000040746 LTR/Copia
ATTTTCTCAAGGAGAATGATCCTCCTTATATAGGGGCTAAACCCATCATCTCTACCCCTCAGATCCGCCC
CCATGAGAGATTTTCTCTCAACCACCCATGATTCACGTTCTCCACCATTCTCTCAACAGAGAAACAGTGG
TTGATTTGGTCATCAATGACCAAGTCAAGCTAACATCTCCCACTTGACCAAATTAACCAAGTGACATGCC
TCCCACTATCCGTGAGATCGGATGTTTCTGCTTACCATTACTCCCACTATCCGTAGAGAGTAACTCTTAT
TTCATTATTCATGAAATTTTACTTGGACTTATTTATTCCTAAGTCCCATCAAACTTACATGTTTGATAAA
2: Protein domain search on dataset 1
9,400 lines
format: fasty36, database: ?
fasty36 -m 3 -m9 -b 1 -H -q -O output.part.0 - /mnt/raid_galaxy/home/galaxy/galaxy-dist/tool-data/domains/TE_domains_newest_Ty1_INT_part_72_137
FASTY compares a DNA sequence to a protein sequence data bank version 36.06 Sep, 2010
Please cite:
Pearson et al, Genomics (1997) 46:24-36
Query: scf7180000040746, 3996 aa
3: Ty1-copia.fasta
5,487 sequences
format: fasta, database: ?
Info:
uploaded fasta file
>scaffold26
TCAGCAACACGTCCGGATATTGCCTATGGAGTACACATCTTGAGCCGGTTTGTCAGTAGTCCGACTTCTATTCACTATGCAGCTCTCATTCGGGTTCTTCGATATCTCAGTGGAACTATAACCCAATCATTATTTGTCCCTTCAGACTCGTCTTTGTCTCTTCGTGCATATTATGATGATGCATAGGCTGATGATCCGGACACTCGGTGTTCTACTACCAGCTTTTGTATTTTTTCTGGGATCATCTCTCACCTCG
TGGCGTAGTAAGCATCAAGCCATTATCTCTCGTTCTAGTACGGAGTCCGAGTACAGGGCATTGGCAGACACTATGTTTGAGCTGAAATGGCTTCGCACTCTTCTGCGAGATCTTGATATCTTTGTTACTACCCCTATCACTTTATACTGTGATAATCAGAGTGTCATCTCCATTTCCACAAATCTGGTCTTTCATGAGCGTACCAAACATATTGAAGTAGATTGTCATGTGGTTTGACAGAAGCATGTTGCTGGCA
ACATTACACTCTCATATGTTGTTTCTAAGGATCACAAATTTGTTTACCAATGCTCAGACAATCTCTCAATTTTGTTCCTTCTTATCCAAACTCTCTATGAACATGTGGTGGGCCACACCCATGAGGACGCGGGAGCAGCAGTTTCGGGCCCTCCCGAAACACATGTGCAGCGAGGCACATGTGCATGCGGGTTTTGTTAAGGCCCAGTTCGGACGTATAAAAGGTAACATCTTCTTTTAGGGTTTTGTGGGGGAAA
ACGTAGAGGAAGAAAAGAGGGTTAGGCAGTGATGCGGCATAATTATGTA
>scaffold62
4: Ty3-gypsy.fasta
3,128 sequences
format: fasta, database: ?
Info:
uploaded fasta file
>scaffold20
TCATTATTTTCGTTGAAGATTCAAAATGACGCATTCATTATTGCTTCGAATCCACAACGCAATCGTCGAACATGACAAGTACTTCGTCCAAAAAGAGGAATGGTGCTGGACAGTTGGGACTATCTAACCTTTAAAAGATTATTGTAGCTATGCGGATGCTCACATATGGAGCATCCGCTGACTCCATTGACGACTACGTTCGGATCGGTGAAAGTACTTCGATTGAGAGTCTGAAGAGGTTCGTCTGATTGATTAT
CGACATCTCTTTAGGGAGGAATACATTCGTTCACCGACTAATGAAGACGTTGCACGCCTGCTTGAGAAATGTTCACAACGAGGTTTTCCTGGTATGCTTGGGAGCATCGACTGCATGCATTGGACATGGAAGAACTGTCCAACTGCTTGGCATGGTATGTACACTGGGCATTTTCATAAACCTACAATTATTTTGGAGGCTGTAGCTAGCAAAGATCTTTGGATATGACATGCCTTCTTTAGACTGTCGGGGTCTC
ATAATGACATCAATGTTCTATATCGTTCACCGGTTTTTGCACAGCTTGCGAAGGGAAGAGCTTCACCGTGCAACTATACTGTCAATGGGCATGAGTACAATATGGAATACTATCTCGCCGACGGGATTTACCTAGAGTGGTTCATATTAGTGAAGACTATTCTAACACCTCGAGGAAAAAAGAATA
>scaffold110
AAGTTAGATCTTCGGTCAAGCTACTATCAGGTCTAAATCCCTGAGGGCGACGAGGTAAAGACTACTTGTGTTACCTAATATGGTGCCTTCGAGTTTCTGGTGATGCCTTTTGGCTGCCCCAGCAACGTTTTGCACCCTGATGAACCGGTTGTTCCACCCCTACCTGGACTGGTTTGTGGTGGTATATCTTGATGACATTGTGGTCTATAGTGGGACGCTTGAAGAGNAGGACACTTGAAGAGCATGTGGAGCACTT
7: Protein domain search on dataset 3
128,177 lines
format: fasty36, database: ?
fasty36 -m 3 -m9 -b 1 -H -q -O output.part.0 - /mnt/raid_galaxy/home/galaxy/galaxy-dist/tool-data/domains/TE_domains_newest_RT
FASTY compares a DNA sequence to a protein sequence data bank version 36.06 Sep, 2010
Please cite:
Pearson et al, Genomics (1997) 46:24-36
Query: scaffold26, 817 aa
8: Protein domain search on dataset 4
72,405 lines
format: fasty36, database: ?
fasty36 -m 3 -m9 -b 1 -H -q -O output.part.0 - /mnt/raid_galaxy/home/galaxy/galaxy-dist/tool-data/domains/TE_domains_newest_RT
FASTY compares a DNA sequence to a protein sequence data bank version 36.06 Sep, 2010
Please cite:
Pearson et al, Genomics (1997) 46:24-36
Query: scaffold20, 698 aa
21: Ty1 domains from dataset-8
4 sequences
format: fasta, database: ?
Info:
keys: Ty1-RT__Wicker_rn_78-53_Os-102

Ty1-RT__Wicker_Bianca_AF521177-1

keys: Ty1-RT__Wicker_rn_78-53_Os-102

Ty1-RT__Wicker_Bianca_AF521177-1

keys: Ty1-RT__Wicker_rn_78-53_Os-102

Ty1-RT__Wicker_Bianca_AF521177-1

keys: Ty1-RT__Wicker_rn_78-53_Os
>scaffold24588_1703-2456
WKGSIQAELNSLAKHEVFGLVLRTIENVKLVVYRWVSAxKxNKENIVIR
YMTCTQGSSQRPNIDYEETYSLVVDTITFxYLISLEINENLDIRLMDA
ITTYLYGHLIMLSIxQSLSKAYNSNSxKIYSIKLHRSLYGLKQSAYM
LYNNLREYLLIEVYKNDLICPCSFIKKSSRIALYVDDSNINGAPE
ELLKGIxYLKKEFEMKDHGKKIKFCLHLQIEHLVNKNLVYNQIIPKRSQ
22: Ty3 domains from dataset-8
290 sequences
format: fasta, database: ?
Info:
keys: Ty1-RT__Wicker_rn_78-53_Os-102

Ty1-RT__Wicker_Bianca_AF521177-1

keys: Ty1-RT__Wicker_rn_78-53_Os-102

Ty1-RT__Wicker_Bianca_AF521177-1

keys: Ty1-RT__Wicker_rn_78-53_Os-102

Ty1-RT__Wicker_Bianca_AF521177-1

keys: Ty1-RT__Wicker_rn_78-53_Os
>scaffold123_3-448
MCMDFTDFNKACLKDSYLLxRIDQLIDESAGYELFSFMDAFYGYYQILM
VEHDLEKTSFITDEGTYFYKVMPFNFKNTGATYQRLVNKIFKHQIGYNVE
AYIDDILIKSKQASSHMSDVEEAFSVLRHYRMKLNPAKCAFGVQSGKFLG
>scaffold280_720-205
IREVQYPExLSNMVLVKKALNKWRMYVDFTNLNKACLKDSxPLPRIDQLV
23: Parsed and filtered fasty36 results from dataset 8
278 lines
format: tabular, database: ?
Info:
keys: Ty1-RT__Wicker_rn_78-53_Os-102

Ty1-RT__Wicker_Bianca_AF521177-1

keys: Ty1-RT__Wicker_rn_78-53_Os-102

Ty1-RT__Wicker_Bianca_AF521177-1

keys: Ty1-RT__Wicker_rn_78-53_Os-102

Ty1-RT__Wicker_Bianca_AF521177-1

keys: Ty1-RT__Wicker_rn_78-53_Os
12345678910111213141516171819202122232425
Typelineagequery_namequery_lengthhit_namehit_lengthstrandoptsbitse_valperc_idperc_simswalenan0ax0pn0px0an1ax1pn1px1gapqgaplfs
Ty3/gypsyOgre/Tatscaffold1231957Ty3-RT__Retand174f60296.71.6e-210.5840.846602149344811957251731174001
Ty3/gypsyOgre/Tatscaffold280848Ty3-RT__Tat4-1174r68997.93e-220.6050.814689172720205848111721174000
Ty3/gypsychromovirusscaffold554867Ty3-RT__PopT_ID202173r765113.36.9e-270.7050.832765173822308867121731173111
Ty3/gypsyOgre/Tatscaffold7773982Ty3-RT__Gypsy-30_SB-I174f49079.93.8e-160.5030.765490149144613982261741174001
Ty3/gypsychromovirusscaffold9161459Ty3-RT__GlyM_ID222173f709113.78.8e-270.6420.86770917373512471145911731173103
33: Aligment from-dataset 22
2,802 lines
format: msf, database: ?
PileUp
MSF: 365 Type: A Check: 0000 ..
Name: scaffold194509_3102-2675 Len: 365 Check: 7212 Weight: 0.00294663
Name: scaffold15394_6130-5688 Len: 365 Check: 8691 Weight: 0.00306914
34: Tree in Newick format from dataset 22
1 line
format: newick, database: ?
((scaffold33982_523-33:17.88256121,scaffold6691_291-805:15.44743879):2.298482958,(((((((scaffold57254_79-577:19.64278334,scaffold98011_32-545:14.29721666):0.8751564366,((scaffold130123_847-1275:20.22518908,scaffold30033_3149-2768:12.76481092):2.807281989,s
caffold174354_879-379:15.13771801):1.642343563):0.7690202044,(scaffold130923_194-682:17.11764856,scaffold74082_1473-961:14.36235144):3.473479796):0.4402971329,((scaffold32337_857-1332:29.86427402,scaffold137750_896-403:27.99572598):3.402672067,scaffold1842
_5607-5087:15.80732793):1.385640367):0.2439746508,(((((scaffold141130_1905-1388:15.50912567,scaffold64842_1795-2315:16.28087433):0.5850269174,((scaffold35992_5692-5174:17.65609756,scaffold83790_605-88:16.06390244):0.8909010321,scaffold168722_53-606:19.5690
9897):1.119973083):0.7617901152,(scaffold52727_735-1209:20.35229356,scaffold44535_521-45:19.50770644):2.210709885):0.4552311531,(scaffold86952_1367-1888:18.07410109,scaffold69435_174-692:16.02589891):1.318206347):0.4741412043,(scaffold22803_2786-2263:17.35
190399,scaffold146535_6-454:15.97809601):1.435702546):0.3897069898):0.2237201451,(((((scaffold195249_826-392:17.41601174,scaffold30557_2722-2259:15.91398826):1.591388357,scaffold104994_1757-1237:19.69361164):0.3042644973,(scaffold38130_1133-623:21.46856873
,scaffold63226_466-987:17.94143127):1.630735503):0.5757807283,((scaffold33303_1783-1275:19.01426925,scaffold64053_968-1468:15.13573075):1.024070313,scaffold214191_672-167:13.20592969):1.062344272):0.2723699471,((scaffold173336_525-1025:19.17150813,scaffold
35: Neighbor joining tree from dataset 22
227.4 KB
format: html, database: ?
HTML file
63: Ty1 domains from dataset-7
51 sequences
format: fasta, database: ?
Info:
keys: Ty1-RT__Copia42-PTR_I

Ty1-RT__Llorens_V12_EU009618.1

Ty1-RT__Llorens_Vitico1-1_AM465428.1

Ty1-RT__Llorens_Tork4_EU105455.1

Ty1-RT__RIRE1_I

Ty1-RT__TNT1_I

Ty1-RT__Copia3-VV_I

Ty1-RT__TNT1_I

Ty1-RT__Wicker_ATCopia78_At_cons

Ty1-RT__
>scaffold3867_1431-661
WRTTMDFEIEAIERNDTWILTDLPAGAKRIDVKWVYKTKLKENGELDKYK
ARLVTKGYAQQQGINYCEVFAPVARMDTVRMVLALAAQRGWTVFQLDVKS
AFLHGELSEEVYVDQPRGYEKKDNLLKVYRLKKALYGLKQAPRAWFSHIE
AHFISEGFEKCYNEHTLFIKTNKEGKILIVSLYVDDLIFTGNDELMFVEF
KKSMLREFDMTDLGRMRYFLGIEVLQGSDGIYICQRKYALEVLKRFRMEN
64: Ty3 domains from dataset-7
2 sequences
format: fasta, database: ?
Info:
keys: Ty1-RT__Copia42-PTR_I

Ty1-RT__Llorens_V12_EU009618.1

Ty1-RT__Llorens_Vitico1-1_AM465428.1

Ty1-RT__Llorens_Tork4_EU105455.1

Ty1-RT__RIRE1_I

Ty1-RT__TNT1_I

Ty1-RT__Copia3-VV_I

Ty1-RT__TNT1_I

Ty1-RT__Wicker_ATCopia78_At_cons

Ty1-RT__
>scaffold110922_167-604
YPExLANMVLVKNALNKWRMCVDFTDLSKACPKDSYPLPRIDxLVDESTG
HxLLGFMDAFSGYNxNFMAEHDxEKTSFITDQGTYCYKMMSFGLKNAVAT
YQRLVNKILKHQTGCNLEAYVDDLVLKLKxVSTHISDLDETFSILR
>Ty3-RT__Retand
IMPCTYPEWLANVVMVKKSSGGWRMCVDFTNLNKACPKDCYPLPRIDSLI
65: Parsed and filtered fasty36 results from dataset 7
35 lines
format: tabular, database: ?
Info:
keys: Ty1-RT__Copia42-PTR_I

Ty1-RT__Llorens_V12_EU009618.1

Ty1-RT__Llorens_Vitico1-1_AM465428.1

Ty1-RT__Llorens_Tork4_EU105455.1

Ty1-RT__RIRE1_I

Ty1-RT__TNT1_I

Ty1-RT__Copia3-VV_I

Ty1-RT__TNT1_I

Ty1-RT__Wicker_ATCopia78_At_cons

Ty1-RT__
12345678910111213141516171819202122232425
Typelineagequery_namequery_lengthhit_namehit_lengthstrandoptsbitse_valperc_idperc_simswalenan0ax0pn0px0an1ax1pn1px1gapqgaplfs
Ty1/copiaIvana/Orycoscaffold38672028Ty1-RT__Copia27-PTR_I257r1445397.28.5e-1120.8210.957144525714316612028112571257000
Ty1/copiaAleIIscaffold68057965Ty1-RT__Copia23-PTR_I255f1004277.63.3e-750.6140.8391004254216429251796542551255022
Ty1/copiaTorkscaffold8464698Ty1-RT__Copia42-PTR_I261r860238.61.7e-640.6120.8218602246662698112241261203
Ty1/copiaAngelascaffold124331015Ty1-RT__Copia-18_SB-I258f1058292.21.7e-800.6050.84110582581749461101512581258001
Ty1/copiaAngelascaffold131161464Ty1-RT__RIRE1_I258r985272.42.2e-740.7030.997920962731464112091258002
66: Aligment from-dataset 63
521 lines
format: msf, database: ?
PileUp
MSF: 287 Type: A Check: 0000 ..
Name: Ty1-RT__Wicker_RomaniAT5_At-3 Len: 287 Check: 6190 Weight: 0.0110271
Name: Ty1-RT__Wicker_Beyla_A_Os_cons Len: 287 Check: 4998 Weight: 0.0146438
67: Tree in Newick format from dataset 63
1 line
format: newick, database: ?
(((Ty1-RT_Wicker_Tara_Os_cons:0.2247222222,Ty1-RT_Wicker_TAR_C_Os6:0.1652777778):19.69237305,Ty1-RT_Wicker_ATCopia95_At-1:24.64262695):3.976556511,(((((((scaffold74526_193-959:17.18134375,scaffold13515_1640-2278:13.14865625):1.273036099,scaffold41329_1483-
726:18.7819639):3.454479802,(scaffold14546_894-138:17.52201613,scaffold135657_1256-492:15.94798387):6.348020198):0.3268818359,Ty1-RT_TNT1_I:14.60811816):1.468308171,((scaffold239300_1650-874:15.40396277,Ty1-RT_TTO1_NT_I:13.93603723):0.9532849702,(scaffold4
0999_880-105:15.70369141,Ty1-RT_Llorens_V12_EU009618.1:12.86630859):1.46171503):1.977941829):3.391828539,(scaffold37523_856-94:23.60637821,Ty1-RT_Copia-31-I_VV:15.61362179):3.740515211):2.382001465,(((scaffold254407_2165-1414:21.37319901,Ty1-RT_Llorens_Tor
k4_EU105455.1:16.22680099):1.699959821,scaffold8464_666-2:22.29504018):0.7708019301,((scaffold172762_152-930:15.78851563,scaffold77540_487-1265:16.13148437):6.927899306,Ty1-RT_Copia42-PTR_I:14.99710069):1.90357307):3.66448291):3.743990364,((((((((((scaffol
d22461_1166-420:22.09306122,Ty1-RT_Wicker_ATCopia78_At_cons:14.59693878):3.628085938,scaffold84078_686-2:19.54191406):1.017165179,scaffold202768_869-1612:20.85033482):1.202558594,((((scaffold168793_1503-737:15.06296274,Ty1-RT_Copia37-PTR_I:13.56703726):2.3
68114099,((scaffold120137_1615-841:15.32677455,scaffold3867_1431-661:13.85322545):1.311951651,scaffold26573_931-1701:14.25304835):2.614385901):1.364952117,scaffold228166_3-722:18.20379788):0.9452572737,Ty1-RT_Copia41-PTR_I:17.79849273):1.549199219):3.19432
68: Neighbor joining tree from dataset 63
51.5 KB
format: html, database: ?
HTML file
78: Ty1 domains from dataset-7
52 sequences
format: fasta, database: ?
Info:
keys: Ty1-RT__Copia42-PTR_I

Ty1-RT__Llorens_V12_EU009618.1

Ty1-RT__Llorens_Vitico1-1_AM465428.1

Ty1-RT__Llorens_Tork4_EU105455.1

Ty1-RT__RIRE1_I

Ty1-RT__TNT1_I

Ty1-RT__Copia3-VV_I

Ty1-RT__TNT1_I

Ty1-RT__Wicker_ATCopia78_At_cons

Ty1-RT__
>scaffold3867_1431-661
WRTTMDFEIEAIERNDTWILTDLPAGAKRIDVKWVYKTKLKENGELDKYK
ARLVTKGYAQQQGINYCEVFAPVARMDTVRMVLALAAQRGWTVFQLDVKS
AFLHGELSEEVYVDQPRGYEKKDNLLKVYRLKKALYGLKQAPRAWFSHIE
AHFISEGFEKCYNEHTLFIKTNKEGKILIVSLYVDDLIFTGNDELMFVEF
KKSMLREFDMTDLGRMRYFLGIEVLQGSDGIYICQRKYALEVLKRFRMEN
79: Ty3 domains from dataset-7
2 sequences
format: fasta, database: ?
Info:
keys: Ty1-RT__Copia42-PTR_I

Ty1-RT__Llorens_V12_EU009618.1

Ty1-RT__Llorens_Vitico1-1_AM465428.1

Ty1-RT__Llorens_Tork4_EU105455.1

Ty1-RT__RIRE1_I

Ty1-RT__TNT1_I

Ty1-RT__Copia3-VV_I

Ty1-RT__TNT1_I

Ty1-RT__Wicker_ATCopia78_At_cons

Ty1-RT__
>scaffold110922_167-604
YPExLANMVLVKNALNKWRMCVDFTDLSKACPKDSYPLPRIDxLVDESTG
HxLLGFMDAFSGYNxNFMAEHDxEKTSFITDQGTYCYKMMSFGLKNAVAT
YQRLVNKILKHQTGCNLEAYVDDLVLKLKxVSTHISDLDETFSILR
>Ty3-RT__Retand
IMPCTYPEWLANVVMVKKSSGGWRMCVDFTNLNKACPKDCYPLPRIDSLI
80: Parsed and filtered fasty36 results from dataset 7
36 lines
format: tabular, database: ?
Info:
keys: Ty1-RT__Copia42-PTR_I

Ty1-RT__Llorens_V12_EU009618.1

Ty1-RT__Llorens_Vitico1-1_AM465428.1

Ty1-RT__Llorens_Tork4_EU105455.1

Ty1-RT__RIRE1_I

Ty1-RT__TNT1_I

Ty1-RT__Copia3-VV_I

Ty1-RT__TNT1_I

Ty1-RT__Wicker_ATCopia78_At_cons

Ty1-RT__
12345678910111213141516171819202122232425
Typelineagequery_namequery_lengthhit_namehit_lengthstrandoptsbitse_valperc_idperc_simswalenan0ax0pn0px0an1ax1pn1px1gapqgaplfs
Ty1/copiaIvana/Orycoscaffold38672028Ty1-RT__Copia27-PTR_I257r1445397.28.5e-1120.8210.957144525714316612028112571257000
Ty1/copiaAleIIscaffold68057965Ty1-RT__Copia23-PTR_I255f1004277.63.3e-750.6140.8391004254216429251796542551255022
Ty1/copiaTorkscaffold8464698Ty1-RT__Copia42-PTR_I261r860238.61.7e-640.6120.8218602246662698112241261203
Ty1/copiaAngelascaffold124331015Ty1-RT__Copia-18_SB-I258f1058292.21.7e-800.6050.84110582581749461101512581258001
Ty1/copiaAngelascaffold131161464Ty1-RT__RIRE1_I258r985272.42.2e-740.7030.997920962731464112091258002
81: Aligment from-dataset 78
528 lines
format: msf, database: ?
PileUp
MSF: 287 Type: A Check: 0000 ..
Name: Ty1-RT__Wicker_RomaniAT5_At-3 Len: 287 Check: 6478 Weight: 0.0108307
Name: Ty1-RT__Wicker_Beyla_A_Os_cons Len: 287 Check: 5286 Weight: 0.0147147
82: Tree in Newick format from dataset 78
1 line
format: newick, database: ?
((scaffold6805_2164-2925:19.63211195,scaffold172808_647-1:17.28788805):3.121481934,((((scaffold144602_1476-700:16.94697351,Ty1-RT_Copia3-VV_I:12.62302649):1.909584554,scaffold247897_1689-926:17.81541545):1.147037842,scaffold46299_1147-1915:22.28796216):1.5
79931641,(Ty1-RT_Copia44-PTR_I:12.7828125,scaffold161108_2938-3640:12.0071875):4.178818359):0.7513305664,(((((Ty1-RT_Copia-8_SB-I:7.063712687,Ty1-RT_Wicker_rn_154-162_Os_cons:5.826287313):7.087792081,Ty1-RT_Wicker_Boba_AY494981-1:14.00220792):1.815845909,s
caffold65615_1425-671:22.60915409):2.858451996,(((scaffold107289_1275-515:18.33791863,Ty1-RT_Wicker_ATCopia83_At-108:16.05208137):8.435229159,Ty1-RT_Wicker_Alva_At-101:22.30977084):1.784184143,((((((((Ty1-RT_Copia-18_SB-I:10.22494485,Ty1-RT_Wicker_Ikeros_A
_102J11-1:11.09505515):7.680360054,scaffold12433_174-946:22.54963995):5.049062681,((((Ty1-RT_RIRE1_I:4.621021127,Ty1-RT_Wicker_Adena_Os_cons:4.288978873):7.255880682,Ty1-RT_Wicker_Anika_At_cons:12.70911932):1.27362793,Ty1-RT_Wicker_Angela_A_cons:13.7463720
7):2.586773438,scaffold13116_627-3:16.33447656):7.772812319):3.313488577,((Ty1-RT_Wicker_Tara_Os_cons:0.2243150685,Ty1-RT_Wicker_TAR_C_Os6:0.1656849315):19.58667565,Ty1-RT_Wicker_ATCopia95_At-1:24.74832435):4.540261423):0.7312065972,(((((((scaffold74526_19
3-959:17.17902664,scaffold13515_1640-2278:13.15097336):1.257857521,scaffold41329_1483-726:18.79714248):3.453236861,(scaffold14546_894-138:17.52960317,scaffold135657_1256-492:15.94039683):6.349263139):0.3065252544,Ty1-RT_TNT1_I:14.62847475):1.459353027,((sc
83: Neighbor joining tree from dataset 78
52.1 KB
format: html, database: ?
HTML file
90: Aligment from-dataset 79
183 lines
format: msf, database: ?
PileUp
MSF: 192 Type: A Check: 0000 ..
Name: Ty3-RT__Reina_ZeaM_ID49 Len: 192 Check: 699 Weight: 0.030496
Name: Ty3-RT__Beetle2_ID78 Len: 192 Check: 310 Weight: 0.0225212
91: Tree in Newick format from dataset 79
1 line
format: newick, database: ?
((((Ty3-RT_RIRE2_I:12.59265625,Ty3-RT_HUCK1-I_ZM:12.11734375):3.385976562,Ty3-RT_Grande1-4:18.16902344):3.472428385,Ty3-RT_RETROSOR1_I:20.80757161):2.732485352,((((((((Ty3-RT_Retrosor2_SorB_ID48:7.882367788,Ty3-RT_Tekay_ZeaM_ID50:9.457632212):6.030948661,T
y3-RT_Peabody_PiSat_ID47:14.19905134):0.512265625,Ty3-RT_Legolas_AraT_ID39:16.39773438):5.000378906,Ty3-RT_Galadriel_LycE_ID42:23.97212109):1.564125434,((Ty3-RT_Gloin_AraT_ID210:20.21492187,Ty3-RT_Gimli_AraT_ID40:21.40507812):0.2164914773,Ty3-RT_Reina_ZeaM
_ID49:20.88350852):1.860249566):0.5649694824,((((Ty3-RT_Cereba1_ID8:5.633868534,Ty3-RT_CRR1_ID14:5.346131466):6.428685662,Ty3-RT_PiSat1_ID200:11.78131434):0.6533837891,Ty3-RT_Beetle1_ID7:11.05161621):1.317908854,((Ty3-RT_SilL1_ID241:6.685357143,Ty3-RT_SilL
2_ID242:6.604642857):4.361631944,Ty3-RT_Beetle2_ID78:13.26836806):2.313966146):9.542921143):9.284671456,((((Ty3-RT_PIGY-1:8.150294118,Ty3-RT_MEGY:7.469705882):3.09859375,Ty3-RT_Athila_AF296831.1:12.00640625):0.7191935484,Ty3-RT_BAGY2:13.21330645):1.5783125
,(Ty3-RT_Calypso:10.96878788,Ty3-RT_Cyclops:11.95121212):3.2379375):17.19986956):6.201669922,(((Ty3-RT_Ogre-PS1:6.764201389,Ty3-RT_Ogre-VP1:5.875798611):4.118639323,Ty3-RT_Ogre-PT1:12.83636068):4.238113839,(Ty3-RT_Ogre-SD1:11.1108875,Ty3-RT_Ogre-LE1:10.149
1125):4.959386161):6.955249023):1.530898437,(((Ty3-RT_ATLANTYS2_I:11.80976902,Ty3-RT_Tat4-1:11.75023098):7.821038411,Ty3-RT_Gret1_I:17.17896159):1.607666016,((Ty3-RT_Retand:17.37639803,scaffold110922_167-604:20.98360197):2.732321777,Ty3-RT_CALYPSHAN2_I_MT:
92: Neighbor joining tree from dataset 79
18.8 KB
format: html, database: ?
HTML file
99: Ty1 domains from dataset-7
71.3 KB
An error occurred running this job:
keys: Ty1-RT__Copia41-PTR_I

Ty1-RT__Tvv1_I

Ty1-RT__Llorens_V12_EU009618.1

Ty1-RT__Llorens_Vitico1-1_AM465428.1

Ty1-RT__Wicker_rn_416-225_Os-6

Ty1-RT__Wicker_ATCopia78_At_cons

Ty1-RT__Tvv1_I

Ty1-RT__Wicker_rn_78-53_Os-102

Ty1-RT__Copia-38-
100: Ty3 domains from dataset-7
1.3 KB
An error occurred running this job:
keys: Ty1-RT__Copia41-PTR_I

Ty1-RT__Tvv1_I

Ty1-RT__Llorens_V12_EU009618.1

Ty1-RT__Llorens_Vitico1-1_AM465428.1

Ty1-RT__Wicker_rn_416-225_Os-6

Ty1-RT__Wicker_ATCopia78_At_cons

Ty1-RT__Tvv1_I

Ty1-RT__Wicker_rn_78-53_Os-102

Ty1-RT__Copia-38-
101: Parsed and filtered fasty36 results from dataset 7
29.4 KB
An error occurred running this job:
keys: Ty1-RT__Copia41-PTR_I

Ty1-RT__Tvv1_I

Ty1-RT__Llorens_V12_EU009618.1

Ty1-RT__Llorens_Vitico1-1_AM465428.1

Ty1-RT__Wicker_rn_416-225_Os-6

Ty1-RT__Wicker_ATCopia78_At_cons

Ty1-RT__Tvv1_I

Ty1-RT__Wicker_rn_78-53_Os-102

Ty1-RT__Copia-38-
102: Ty1 domains from dataset-7
266 sequences
format: fasta, database: ?
Info:
selected sequences:
scaffold101056_1119-487 scaffold101118_776-1506 scaffold102413_729-11 scaffold103009_9671-8925 scaffold104187_1244-518 scaffold10677_1838-1100 scaffold107289_1275-515 scaffold107705_2292-2965 scaffold10846_1402-2145 scaffold110910_1-6
>scaffold1863_972-259
WEHTMQEKIDSLYSNEAxELAQLPAQKKALHDKWVYRVNQESDGTKRYNS
RLVVKGFxQWEGVDYMMIFSPVVKLTTIRVVLTLITIENLYLEHLDVKIV
FLHGDLDEEIYIKQLISFIExRNEEMVCRLKKSLYGLKQAPRQWYKKFDN
FMQSNGYSTYNSNHYCYFKRFESSYIMLLLYVDNMLV
AMKDLDTAKxILVMxISHDVTEGILRLSRAEYIEKVFQRFNTEN
103: Ty3 domains from dataset-7
7 sequences
format: fasta, database: ?
Info:
selected sequences:
scaffold101056_1119-487 scaffold101118_776-1506 scaffold102413_729-11 scaffold103009_9671-8925 scaffold104187_1244-518 scaffold10677_1838-1100 scaffold107289_1275-515 scaffold107705_2292-2965 scaffold10846_1402-2145 scaffold110910_1-6
>scaffold107871_7078-6599
YPEWLxNMVLVKKPSDKWRMCFNYTDLNKACLKDSFRLPQIDxLIDGSAS
HEILSFMDDFLGYNQIKMVEHDKVIGPTAYSRQMMSFKLKNAM
ATHQRLINKEQSSHNVEAYVDDILVKSKHANSRVVGLEEPFLVLYQY
RMKLNPMKCVFRVLSSKFLG
>scaffold110922_167-604
104: Parsed and filtered fasty36 results from dataset 7
213 lines
format: tabular, database: ?
Info:
selected sequences:
scaffold101056_1119-487 scaffold101118_776-1506 scaffold102413_729-11 scaffold103009_9671-8925 scaffold104187_1244-518 scaffold10677_1838-1100 scaffold107289_1275-515 scaffold107705_2292-2965 scaffold10846_1402-2145 scaffold110910_1-6
12345678910111213141516171819202122232425
Typelineagequery_namequery_lengthhit_namehit_lengthstrandoptsbitse_valperc_idperc_simswalenan0ax0pn0px0an1ax1pn1px1gapqgaplfs
Ty1/copiaTorkscaffold18631118Ty1-RT__Copia-31-I_VV257r8212284.1e-610.5490.79893425797225911181125712571900
Ty1/copiaunclass(AleI/Retrofit)scaffold32709145Ty1-RT__Llorens_Vitico1-2_AM462010.2256r819227.54.8e-600.590.7428372563621294491451125612563002
Ty1/copiaIvana/Orycoscaffold38672028Ty1-RT__Copia27-PTR_I257r1445397.28.5e-1120.8210.957144525714316612028112571257000
Ty1/copiaunclass(Ale)scaffold3885892Ty1-RT__Wicker_Leojyg_AY268139-1254r527148.23.3e-370.4030.62252723867728921223412541351
Ty1/copiaunclass(Ale)scaffold39822130Ty1-RT__Wicker_rn_78-53_Os-102254f874242.33.7e-650.5670.7787425273614761213022531254403
105: Aligment from-dataset 102
4,499 lines
format: msf, database: ?
PileUp
MSF: 744 Type: A Check: 0000 ..
Name: scaffold24588_1703-2456 Len: 744 Check: 4516 Weight: 0.00449267
Name: scaffold10677_1838-1100 Len: 744 Check: 1044 Weight: 0.00374445
106: Tree in Newick format from dataset 102
1 line
format: newick, database: ?
(Ty1-RT_Copia52-PTR_I:22.54707438,Ty1-RT_MTCOPIA2_I:24.51292562,(((((((((((((scaffold32588_610-1150:20.73749013,scaffold161529_930-1696:19.04250987):2.273960571,scaffold82754_976-246:18.41603943):0.3203656506,scaffold64838_3558-2796:22.87213435):0.57035644
53,scaffold30391_23-791:22.13464355):1.424144007,scaffold68909_4631-3732:22.93835599):1.296923319,scaffold28106_8965-9719:22.05338918):3.63638411,Ty1-RT_Tvv1_I:19.39455339):1.473759258,scaffold84808_386-1154:27.84514699):1.138531934,scaffold12236_1040-290:
25.67498369):0.9796920504,((scaffold48509_165-821:16.39469705,scaffold85328_3756-3045:13.50530295):7.798626734,scaffold11700_452-1223:22.39637327):4.487573575):0.5310549752,((((((Ty1-RT_Copia23-PTR_I:9.751086354,Ty1-RT_SHACOP11_I_MT:9.858913646):4.61201884
8,scaffold221351_4412-5152:18.84798115):1.867763866,((Ty1-RT_Copia44-PTR_I:13.78507701,scaffold161108_2938-3640:12.28492299):1.402793983,Ty1-RT_Copia38-PTR_I:15.75220602):3.257236134):0.5586062542,((scaffold35829_1094-1864:18.60318491,scaffold6805_2164-292
5:19.09681509):0.7525534997,scaffold172808_647-1:17.5474465):2.608893746):0.70609872,((scaffold144602_1476-700:19.53272491,scaffold247897_1689-926:19.28727509):0.6036471956,scaffold46299_1147-1915:22.5313528):1.90577628):0.4511312866,(((Ty1-RT_Copia-8_SB-I
:6.829995174,Ty1-RT_Wicker_rn_154-162_Os_cons:6.060004826):7.145255114,Ty1-RT_Wicker_Boba_AY494981-1:13.94474489):3.10712005,scaffold65615_1425-671:21.31787995):2.483282776):2.928732622):0.9098187226,(((((((((((((((scaffold41725_617-2:19.19054167,scaffold2
107: Neighbor joining tree from dataset 102
421.4 KB
format: html, database: ?
HTML file